Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOR1/OSCP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NOR1/OSCP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NOR1/OSCP1 Polyclonal specifically detects NOR1/OSCP1 in Human samples. It is validated for Western Blot.Specifications
NOR1/OSCP1 | |
Polyclonal | |
Rabbit | |
C1orf102, NOR1, OSCP1 organic solute carrier partner 1 | |
OSCP1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
127700 | |
Synthetic peptides corresponding to C1ORF102 The peptide sequence was selected from the N terminal of C1ORF102. Peptide sequence MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title