Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NORE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | NORE1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
NORE1 Polyclonal specifically detects NORE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NORE1 | |
| Unconjugated | |
| RUO | |
| Human | |
| Maxp1, MGC10823, MGC17344, New ras effector 1, NORE1A, NORE1B, NORE1RASSF3, Rap1-binding protein, RAPLnovel Ras effector 1, Ras association (RalGDS/AF-6) domain family 5, Ras association (RalGDS/AF-6) domain family member 5, ras association domain-containing protein 5, Ras effector-like protein, regulator for cell adhesion and polarization enriched in lymphoid tissue, Regulator for cell adhesion and polarization enriched in lymphoid tissues, tumor suppressor RASSF3 | |
| RASSF5 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| Cancer, Signal Transduction, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 83593 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title