NOV/CCN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418275	Novus Biologicals NBP18815425UL	25 μL
NBP188154	Novus Biologicals NBP188154	0.1 mL

Description

NOV/CCN3 Polyclonal specifically detects NOV/CCN3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NOV/CCN3
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 4856
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CCN family member 3, CCN3IGF-binding protein 9, IBP-9, IGFBP-9, IGFBP9novH, Insulin-like growth factor-binding protein 9, nephroblastoma overexpressed gene, Nephroblastoma-overexpressed gene protein homolog, NOVH, protein NOV homolog
• Gene Symbols: CCN3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only