Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nova2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157296
Description
Nova2 Polyclonal specifically detects Nova2 in Human samples. It is validated for Western Blot.Specifications
Nova2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
neuro-oncological ventral antigen 2ANOVANOVA3Astrocytic NOVA1-like RNA-binding protein, neuro-oncological ventral antigen 3, RNA-binding protein Nova-2 | |
Rabbit | |
Protein A purified | |
RUO | |
4858 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9UNW9 | |
NOVA2 | |
Synthetic peptides corresponding to NOVA2 (neuro-oncological ventral antigen 2) The peptide sequence was selected from the middle region of NOVA2. Peptide sequence EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction