Nova2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157296

Catalog No. NBP157296

Description

Nova2 Polyclonal specifically detects Nova2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Nova2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: neuro-oncological ventral antigen 2ANOVANOVA3Astrocytic NOVA1-like RNA-binding protein, neuro-oncological ventral antigen 3, RNA-binding protein Nova-2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4858
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UNW9
• Gene Symbols: NOVA2
• Immunogen: Synthetic peptides corresponding to NOVA2 (neuro-oncological ventral antigen 2) The peptide sequence was selected from the middle region of NOVA2. Peptide sequence EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only