Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118366

Novus Biologicals™ Recombinant E. coli Disulfide-bond isomerase Protein
SDP

Catalog No. NBC118366 Shop All R&D Systems Products
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBC118366 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118366 Supplier Novus Biologicals™ Supplier No. NBC118366
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 21-236 of E.coli Disulfide-bond isomerase The Recombinant E. coli Disulfide-bond isomerase Protein is derived from E. coli. The Recombinant E. coli Disulfide-bond isomerase Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris buffer (pH 7.5), 2mM EDTA
Molecular Weight (g/mol) 23.4kDa
Name Disulfide-bond isomerase Protein
Purification Method Protein
Immunogen DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYVLGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Purity or Quality Grade >95%, by SDS-PAGE
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.