Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ EB3 Protein
SDP

Catalog No. NBP14943201 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
0.5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP14943201 0.1 mg
NBP1494325 0.5 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP14943201 Supplier Novus Biologicals™ Supplier No. NBP1494320.1MG
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-281 of Human EB3 The Recombinant Human EB3 Protein is derived from E. coli. The Recombinant Human EB3 Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl
Gene ID (Entrez) 22924
Molecular Weight (g/mol) 34.1kDa
Purification Method Protein
Quantity 0.1 mg
Source Human
Immunogen MAPRE3, 1-281 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name EB3
Conjugate Unconjugated
Purity or Quality Grade >90%
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.