Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Novus Biologicals™ HIF-1 alpha Protein

Novus Biologicals™ HIF-1 alpha Protein
SDP

Catalog No. p-5354837
Click to view available options
Quantity:
0.01 mg
0.05 mg

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-85 of Human HIF-1 alpha The Recombinant Human HIF-1 alpha Protein is derived from E. coli. The Recombinant Human HIF-1 alpha Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 0.25mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation Liquid. In 20mM Tris buffer (pH 8.0) containing 20% glycerol, 1mM DTT, 0.2M NaCl, 1mM EDTA.
Gene ID (Entrez) 3091
Molecular Weight (g/mol) 11.8kDa
Purification Method Protein
Quantity 0.01 mg
Source Human
Immunogen HIF1a, 1-85 aa MGSSHHHHHHSSGLVPRGSHMEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMK
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name HIF-1 alpha
Conjugate Unconjugated
Purity or Quality Grade >80%
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.