Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118420

Novus Biologicals™ Recombinant Human CEBP gamma His Protein
SDP

Catalog No. NBC118420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118420 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118420 Supplier Novus Biologicals™ Supplier No. NBC118420
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

A Human recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 39-147 of Human CEBP gamma The Recombinant Human CEBP gamma Protein is derived from E. coli. The Recombinant Human CEBP gamma Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_001797
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 7.5) 0.1 M NaCl, 5mM beta-Mercaptoethanol
Gene ID (Entrez) 1054
Molecular Weight (g/mol) 16.5kDa
Name CEBP gamma Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDN
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Research Category Cell Cycle and Replication
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.