Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human Cofilin His Protein
SDP

Catalog No. NBC118535 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118535 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118535 Supplier Novus Biologicals™ Supplier No. NBC118535
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-166 of Human Cofilin The Recombinant Human Cofilin Protein is derived from E. coli. The Recombinant Human Cofilin Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP _005498
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 10% glycerol
Gene ID (Entrez) 1072
Molecular Weight (g/mol) M.W. (theoretical): 20 kDa
Name Cofilin Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Endotoxin Concentration <1.0 EU / 1 μg of protein (determined by LAL method)
Gene Symbol CFL1
Cross Reactivity Human
Research Category Cell Biology, Cellular Markers
Purity or Quality Grade >95%, by SDS-PAGE
Protein Cofilin
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.