Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human CRABP2 Protein
SDP

Catalog No. NBC118490 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118490 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118490 Supplier Novus Biologicals™ Supplier No. NBC118490
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids1-138 of Human E.coli CRABP2 The Recombinant Human CRABP2 Protein is derived from E. coli. The Recombinant Human CRABP2 Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_001869
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 20% glycerol
Gene ID (Entrez) 1382
Molecular Weight (g/mol) M.W. (theoretical): 15.6 kDa
Name CRABP2 Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Endotoxin Concentration <1.0 EU / 1 μg of protein (determined by LAL method)
Gene Symbol CRABP2
Cross Reactivity Human
Research Category Core ESC Like Genes, Neuroscience, Stem Cell Markers
Purity or Quality Grade >95%, by SDS-PAGE
Protein CRABP2
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.