Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human Cyclophilin-F His Protein
SDP

Catalog No. NBC118533 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118533 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118533 Supplier Novus Biologicals™ Supplier No. NBC118533
Add to Cart
Add to Cart

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Western Blot, Immunoprecipitation, Functional, SDS-Page, Bioactivity

Specific activity is > 900 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAPF-pNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin.

Specifications

Accession Number NP_005720
For Use With (Application) Bioactivity, Immunoprecipitation, SDS-PAGE, Western Blot
Formulation 20mM Tris buffer (pH 7.5), 1mM DTT, 10% glycerol
Gene ID (Entrez) 10105
Molecular Weight (g/mol) 21kDa
Name Cyclophilin-F Protein
Purification Method Protein
Quantity 0.1 mg
Source E. Coli
Immunogen 30-207aa, GSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Research Category Proteases & Other Enzymes
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.