Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Human FGF acidic/FGF1 Protein
SDP

Catalog No. NBP226558 Shop All R&D Systems Products
Change view
Click to view available options
50μg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBP226558 50μg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP226558 Supplier Novus Biologicals™ Supplier No. NBP226558

Highly purified and high bioactivity. Generating reliable and reproducible results.

Recombinant biologically active FGF1 protein. Source:E. coli Amino Acid Sequence: MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD The Recombinant Human FGF acidic/FGF1 Protein is derived from E. coli. The Recombinant Human FGF acidic/FGF1 Protein has been validated for the following applications: Bioactivity.

Specifications

Gene ID (Entrez) 2246
Name FGF acidic/FGF1 protein
Purification Method SDS-PAGE
Storage Requirements 4°C short term, −20°C long term. Avoid freeze-thaw cycles.
Cross Reactivity Human
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.