Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118374

Novus Biologicals™ Recombinant Human HSPH1/HSP105 His Protein
SDP

Catalog No. NBC118374 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118374 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118374 Supplier Novus Biologicals™ Supplier No. NBC118374
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-858 of Human HSPH1/HSP105 The Recombinant Human HSPH1/HSP105 Protein is derived from E. coli. The Recombinant Human HSPH1/HSP105 Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_006635
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 50 mM NaCl
Gene ID (Entrez) 10808
Molecular Weight (g/mol) M.W. (theoretical): 100.9 kDa
Name HSPH1/HSP105 Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLTKLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGK
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Gene Symbol HSPH1
Cross Reactivity Human
Purity or Quality Grade >90%, by SDS-PAGE
Protein HSPH1/HSP105
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.