Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Novus Biologicals™ IMPA1 Protein

Novus Biologicals™ IMPA1 Protein
SDP

Catalog No. NBP1493045 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
0.5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1493045 0.5 mg
NBP14930401 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1493045 Supplier Novus Biologicals™ Supplier No. NBP1493040.5MG
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-277 of Human IMPA1 The Recombinant Human IMPA1 Protein is derived from E. coli. The Recombinant Human IMPA1 Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1mg/mL
For Use With (Application) ELISA, SDS-PAGE
Gene ID (Entrez) 3612
Molecular Weight (g/mol) 32.3kDa
Purification Method Protein
Quantity 0.5 mg
Source Human
Immunogen IMPA1, 1-277aa. Sequence: MGSSHHHHHHSSGLVPRGSHMADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name IMPA1
Conjugate Unconjugated
Purity or Quality Grade >95%
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.