Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Novus Biologicals™ MTH1 Protein

Novus Biologicals™ MTH1 Protein
SDP

Catalog No. NBP1493095 Shop All Novus Biologicals Products
Click to view available options
Quantity:
0.1 mg
0.5 mg

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-156 of Human MTH1 The Recombinant Human MTH1 Protein is derived from E. coli. The Recombinant Human MTH1 Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl
Gene ID (Entrez) 4521
Molecular Weight (g/mol) 20.1kDa
Purification Method Protein
Quantity 0.5 mg
Source Human
Immunogen NUDT1, 1-156aa. MGSSHHHHHHSSGLVPRGSHMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name MTH1
Conjugate Unconjugated
Purity or Quality Grade >95%
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.