Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Shwachman Bodian-Diamond syndrome Protein
SDP

Catalog No. NBP14945001 Shop All Novus Biologicals Products
Click to view available options
Quantity:
0.1 mg
0.5 mg

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-250 of Human Shwachman Bodian-Diamond syndrome The Recombinant Human Shwachman Bodian-Diamond syndrome Protein is derived from E. coli. The Recombinant Human Shwachman Bodian-Diamond syndrome Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 0.5mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 50mM NaCl, 0.1mM EDTA
Gene ID (Entrez) 51119
Molecular Weight (g/mol) 30.9kDa
Purification Method Protein
Quantity 0.1 mg
Source Human
Immunogen SBDS, 1-250aa. Sequence: MGSSHHHHHHSSGLVPRGSHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name Shwachman Bodian-Diamond syndrome
Conjugate Unconjugated
Purity or Quality Grade >95%
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.