Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP157049E

Novus Biologicals™ ZDHHC21 Antibody Blocking Peptide
SDP

Catalog No. NBP157049E Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157049E 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157049E Supplier Novus Biologicals™ Supplier No. NBP157049PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A blocking peptide from human ZDHHC21. Source: Synthetic Amino Acid Sequence: (Accession #: NP_848661)ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV. The ZDHHC21 Blocking Peptide is derived from Synthetic. The ZDHHC21 Blocking Peptide has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 340481
Species Human
Purification Method Peptide affinity purified
Content And Storage Store at -20 C. Avoid freeze-thaw cycles.
Formulation Lyophilized from sterile distilled water.
For Use With (Application) This Peptide is Useful as a Blocking Peptide for NBP1-57049. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Alias DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik
Gene Symbol ZDHHC21
Molecular Weight (g/mol) 31kDa
Product Type ZDHHC21
Quantity 100 μg
Regulatory Status RUO - research use only
Termination Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.