Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOX3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP2841900.1ML
Description
NOX3 Polyclonal specifically detects NOX3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NOX3 | |
Polyclonal | |
PBS, 2% Sucrose | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
50508 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
EC 1.6.3, GP91-3EC 1.6.3.-, gp91phox homolog 3, Mitogenic oxidase 2, MOX2, MOX-2, NADPH oxidase 3, NADPH oxidase catalytic subunit-like 3 | |
The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF | |
0.1 mL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction