Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB032118

NOX3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB032118 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB032118 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB032118 Supplier Novus Biologicals Supplier No. NBP2841900.1ML
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

NOX3 Polyclonal specifically detects NOX3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen NOX3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS, 2% Sucrose
Gene Alias EC 1.6.3, GP91-3EC 1.6.3.-, gp91phox homolog 3, Mitogenic oxidase 2, MOX2, MOX-2, NADPH oxidase 3, NADPH oxidase catalytic subunit-like 3
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 50508
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.