Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ NPAS1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258842PEP

Catalog No. NBP258842PE


Add to Cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPAS1. Source: E.coli Amino Acid Sequence: VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV The NPAS1 Recombinant Protein Antigen is derived from E. coli. The NPAS1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

4861
NPAS1 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
Basic-helix-loop-helix-PAS protein MOP5, BHLHE11, bHLHe11member of PAS superfamily 5, Class E basic helix-loop-helix protein 11, Member of PAS protein 5, MOP5Neuronal PAS1, neuronal PAS domain protein 1, neuronal PAS domain-containing protein 1, PASD5PAS
Unlabeled
100μL
E.coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
NPAS1
Recombinant Protein Antigen
RUO
Human
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only.