Invitrogen™ NPC2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579755

Catalog No. PIPA579755

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SK-OV-3 whole cell. IHC: human lung cancer tissue, human intestinal cancer tissue.

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

Specifications

• Antigen: NPC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: NPC2
• Gene Alias: 2700012J19Rik; AA408070; AU045843; EDDM1; epididymal protein 1; epididymal secretory protein 1; epididymal secretory protein E1; HE1; human epididymis-specific protein 1; mE1; MGC1333; Niemann Pick type C2; niemann Pick type C2 protein homolog; Niemann-Pick disease type C2 protein; Niemann-Pick disease, type C2; Niemann-Pick type C2; NPC intracellular cholesterol transporter 2; Npc2; NP-C2; re1; tissue-specific secretory protein
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10577
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P61916
• Gene Symbols: NPC2
• Immunogen: A synthetic peptide corresponding to a sequence of human Niemann Pick C2 (KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov