Abnova™ NR2E3 Recombinant Protein

Human full-length ORF recombinant protein with GST-tag at N-terminal

Supplier:  Abnova™ H00010002P0125

Catalog No. 89-011-717

Description

• Encoded by nuclear receptor subfamily 2, group E, member 3 gene
• Molecular weight: 61.16kDa
• Preparation method: in vitro wheat germ expression system
• Purification: glutathione sepharose 4 fast flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
• pH=8.0 in elution buffer

Sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSC
PLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN

Best when used within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH41421
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 61.16
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 25 ug
• Immunogen: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
• Gene Alias: ESCS/MGC49976/PNR/RNR/RP37/rd7
• Gene Symbol: NR2E3
• Species: Wheat Germ (in vitro)
• Protein Tag: GST

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 10002
• Name: NR2E3 (Human) Recombinant Protein (P01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: NR2E3
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution