Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579761

Invitrogen™ NR3C2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579761
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579761 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579761 Supplier Invitrogen™ Supplier No. PA579761
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human 293T whole cell, human LNCAP whole cell, human MCF-7 whole cell, rat NRK whole cell, mouse NIH/3T3 whole cell. ICC/IF: U20S cell.

Steroid receptors are ligand-dependent, intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Mineralocorticoids are a family of steroids, secreted by the adrenal cortex, necessary for the regulation of a number of metabolic processes including electrolyte regulation. These compounds exert their effect through their interaction with the mineralocorticoid receptor (MR) and that complex's subsequent association with DNA. Given the function of mineralocorticoids, it is not surprising to find that the kidney is a primary target organ for mineralocorticoids and that this organ has been shown to contain MR. The corresponding gene for the mineralocorticoid receptor is NR3C2.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NR3C2
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene NR3C2
Gene Accession No. P08235, P22199, Q8VII8
Gene Alias aldosterone receptor; MCR; Mineralocorticoid receptor; Mineralocorticoid receptor (aldosterone receptor); mineralocorticoid receptor 1; mineralocorticoid receptor 2; mineralocorticoid receptor delta; Mlr; MR; NR3C2; NR3C2VIT; nuclear hormone receptor; nuclear receptor subfamily 3 group C member 2; nuclear receptor subfamily 3, group C, member 2; nuclear receptor subfamily 3, group C, member 2 variant 3
Gene Symbols NR3C2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 110784, 25672, 4306
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.