Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRAMP2/SLC11A2/DMT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP159869
Description
NRAMP2/SLC11A2/DMT1 Polyclonal specifically detects NRAMP2/SLC11A2/DMT1 in Human samples. It is validated for Western Blot.Specifications
NRAMP2/SLC11A2/DMT1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters) | |
Rabbit | |
61 kDa | |
100 μL | |
Primary | |
Specific to all four isoforms of the SLC11A2 transporter. | |
Human, Rat | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q498Z5 | |
SLC11A2 | |
Synthetic peptides corresponding to SLC11A2 The peptide sequence was selected from the N terminal of SLC11A2 (NP_000608). Peptide sequence VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF. | |
Affinity purified | |
RUO | |
4891 | |
Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction