NRAMP2/SLC11A2/DMT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP159869

Catalog No. NBP159869

Description

NRAMP2/SLC11A2/DMT1 Polyclonal specifically detects NRAMP2/SLC11A2/DMT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NRAMP2/SLC11A2/DMT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters)
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specific to all four isoforms of the SLC11A2 transporter.
• Target Species: Human, Rat
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q498Z5
• Gene Symbols: SLC11A2
• Immunogen: Synthetic peptides corresponding to SLC11A2 The peptide sequence was selected from the N terminal of SLC11A2 (NP_000608). Peptide sequence VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4891
• Reconstitution: Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only