Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NrCAM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NrCAM |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NrCAM Polyclonal specifically detects NrCAM in Human samples. It is validated for Western Blot.Specifications
NrCAM | |
Polyclonal | |
Rabbit | |
Q4KMQ7 | |
4897 | |
Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
bravo, hBravo, KIAA0343Neuronal surface protein Bravo, MGC138845, MGC138846, neuronal cell adhesion molecule, Ng-CAM-related, NgCAM-related cell adhesion molecule, nr-CAM | |
NRCAM | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title