Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NRIF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	NRIF3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159187 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159187	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NRIF3 Polyclonal specifically detects NRIF3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	NRIF3
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Apoptosis
Gene Accession No.	Q13352
Gene ID (Entrez)	23421
Immunogen	Synthetic peptides corresponding to ITGB3BP(integrin beta 3 binding protein (beta3-endonexin)) The peptide sequence was selected from the N terminal of ITGB3BP (NP_055103). Peptide sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	beta-3-endonexin, CENP-R, centromere protein R, HSU37139, integrin beta 3 binding protein (beta3-endonexin), Integrin beta-3-binding protein, NRIF3CENPRbeta 3 endonexin, Nuclear receptor-interacting factor 3, TAP20
Gene Symbols	ITGB3BP
Isotype	IgG
Molecular Weight of Antigen	20 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NRIF3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents