Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRIF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NRIF3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159187
|
Novus Biologicals
NBP159187 |
100 μL |
Each for $436.00
|
|
NBP15918720
|
Novus Biologicals
NBP15918720UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
NRIF3 Polyclonal specifically detects NRIF3 in Human samples. It is validated for Western Blot.Specifications
| NRIF3 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| beta-3-endonexin, CENP-R, centromere protein R, HSU37139, integrin beta 3 binding protein (beta3-endonexin), Integrin beta-3-binding protein, NRIF3CENPRbeta 3 endonexin, Nuclear receptor-interacting factor 3, TAP20 | |
| ITGB3BP | |
| IgG | |
| Affinity Purified | |
| 20 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13352 | |
| 23421 | |
| Synthetic peptides corresponding to ITGB3BP(integrin beta 3 binding protein (beta3-endonexin)) The peptide sequence was selected from the N terminal of ITGB3BP (NP_055103). Peptide sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title