Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRIP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25507025UL
Description
NRIP Polyclonal specifically detects NRIP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
NRIP | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
1200006M05Rik, Androgen receptor complex-associated protein, ARCAP, DDB1 and CUL4 associated factor 6, DDB1- and CUL4-associated factor 6, FLJ23798, IQ motif and WD repeat-containing protein 1, IQ motif and WD repeats 1, IQWD1, MSTP055, NRIP, Nuclear receptor interaction protein, PC326 | |
Rabbit | |
Affinity Purified | |
RUO | |
55827 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
DCAF6 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATG | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction