Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nse2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	Nse2
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP258712 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP258712	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393315 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25871225UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Nse2 Polyclonal specifically detects Nse2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	Nse2
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	286053
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	C8orf36, E3 SUMO-protein ligase NSE2, EC 6.3.2, EC 6.3.2.-, FLJ32440, hMMS21, methyl methanesulfonate sensitivity gene 21, MMS21 homolog, MMS21chromosome 8 open reading frame 36, Non-SMC element 2 homolog, non-SMC element 2 homolog (MMS21, S. cerevisiae), non-SMC element 2, MMS21 homolog (S. cerevisiae), Non-structural maintenance of chromosomes element 2 homolog, NSE2
Gene Symbols	NSMCE2
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Nse2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents