Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NSFL1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$416.50 - $684.50

Specifications

Antigen	NSFL1C
Dilution	Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB438362 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP21367725UL	25ul	Each for $416.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP213677 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP213677	0.1 mL	Each for $684.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NSFL1C Polyclonal specifically detects NSFL1C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	NSFL1C
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	55968
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	dJ776F14.1, NSFL1 (p97) cofactor (p47), NSFL1 cofactor p47, p47, p97 cofactor p47, SHP1 homolog, UBX domain protein 2C, UBX domain-containing protein 2C, UBX1, UBXD10, UBXN2CMGC3347
Gene Symbols	NSFL1C
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NSFL1C Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents