NSUN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25829225UL

Catalog No. NB393525

Description

NSUN3 Polyclonal specifically detects NSUN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NSUN3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 2.1.1, EC 2.1.1.-, FLJ22109, FLJ22609, MST077, NOL1/NOP2/Sun domain family 3, NOL1/NOP2/Sun domain family member 3, NOL1/NOP2/Sun domain family, member 3, NOP2/Sun domain family, member 3, putative methyltransferase NSUN3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63899
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NSUN3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only