NT-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238196

Catalog No. NBP238196

Description

NT-3 Polyclonal specifically detects NT-3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Neurotrophin 3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P20783
• Gene Symbols: NTF3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NMDQRRLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDT
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer
• Gene ID (Entrez): 4908
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: HDNF, MGC129711, Nerve growth factor 2, Neurotrophic factor, neurotrophin 3, neurotrophin-3, NGF2, NGF-2, NT3, NT-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.