Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NT5E Rabbit anti-Human, Mouse, Rat, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human NT5E.

Manufacturer:  Abnova Corporation PAB29314

Catalog No. 89-934-709


Add to cart

Description

Description

Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation. Consequently, a deficiency of NT5 occurs in a variety of immunodeficiency diseases (e.g., see MIM 102700, MIM 300300). Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes and can be distinguished from ecto-NT5 by their substrate affinities, requirement for divalent magnesium ion, activation by ATP, and inhibition by inorganic phosphate.[supplied by OMIM]

Sequence: EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Specifications

Specifications

NT5E
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Liquid
NT5E
Recombinant protein corresponding to amino acids 118-232 of human NT5E.
Antigen affinity purification
RUO
Primary
4907
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant human NT5E.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
CD73/E5NT/NT/NT5/NTE/eN/eNT
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human, Murine, Rat
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit