Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NT5M Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	NT5M
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154683 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154683	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NT5M Polyclonal specifically detects NT5M in Human samples. It is validated for Western Blot.

Specifications

Antigen	NT5M
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Gene Alias	3'-nucleotidase, mitochondrialDNT2, 5', 5' nucleotidase, mitochondrial, 5(3)-deoxyribonucleotidase, Deoxy-5'-nucleotidase 2, dNT2, dNT-25'(3')-deoxyribonucleotidase, mitochondrial, EC 3.1.3, EC 3.1.3.-, mdN, mitochondrial 5' nucleotidase
Gene Symbols	NT5M
Isotype	IgG
Molecular Weight of Antigen	23 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9NPB1
Gene ID (Entrez)	56953
Immunogen	Synthetic peptides corresponding to NT5M(5',3'-nucleotidase, mitochondrial) The peptide sequence was selected from the N terminal of NT5M. Peptide sequence ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NT5M Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents