NTB-A/SLAMF6/CD352 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24900225UL

Catalog No. NB395896

Description

NTB-A/SLAMF6/CD352 Polyclonal antibody specifically detects NTB-A/SLAMF6/CD352 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NTB-A/SLAMF6/CD352
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Activating NK receptor, CD352 antigen, KALIFLJ50657, Ly108, NK-T-B-antigen, NTBA receptor, NTB-AMGC104953, NTBAT- and B-cell antigen, SF2000, SLAM family member 6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT
• Quantity: 25 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 114836
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified