Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NTCP Polyclonal Antibody

Supplier: Thermo Scientific PA580001

Catalog No. PIPA580001

$526.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

NTCP Polyclonal Antibody for Western Blot, IHC (F), IHC (P), Flow

Specifications

Antigen	NTCP
Classification	Polyclonal
Conjugate	Unconjugated
Gene	SLC10A1
Gene Alias	bile acid cotransporting polypeptide; cell growth-inhibiting gene 29 protein; GIG29; growth-inhibiting protein 29; hepatic sodium-dependent bile acid transporter; LOW QUALITY PROTEIN: sodium/bile acid cotransporter; MGC128766 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NA-dependent cholate transporting protein; Ntcp; Ntcp1; SBACT; Slc10a1; sodium bile acid cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; sodium/taurocholate cotransporter; sodium/taurocholate cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 (sodium/bile acid cotransporter), member 1; solute carrier family 10 member 1; solute carrier family 10, member 1
Host Species	Rabbit
Purification Method	Antigen affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	20493, 24777
Content And Storage	-20°C
Form	Lyophilized

Applications	Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration	500 μg/mL
Formulation	PBS with 4mg trehalose and no preservative
Gene Accession No.	O08705, P26435
Gene Symbols	SLC10A1
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK).
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Mouse, Rat
Product Type	Antibody
Isotype	IgG

Product Suggestions Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

NTCP Polyclonal Antibody

Description

Specifications

Product Suggestions

Safety and Handling

Documents

Promotions