Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nuclear Factor Erythroid 2 Related Factor 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | Nuclear Factor Erythroid 2 Related Factor 1 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Nuclear Factor Erythroid 2 Related Factor 1 Polyclonal specifically detects Nuclear Factor Erythroid 2 Related Factor 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Nuclear Factor Erythroid 2 Related Factor 1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11, Transcription factor 11, transcription factor 11 (basic leucine zipper type), Transcription factor HBZ17, Transcription factor LCR-F1 | |
NFE2L1 | |
IgG | |
Affinity Purified |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Human | |
Q14494 | |
4779 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title