NUDT12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152974

Catalog No. NBP152974

Description

NUDT12 Polyclonal specifically detects NUDT12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NUDT12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp761I172, EC 3.6.1.22, nucleoside diphosphate linked moiety X-type motif 12, Nucleoside diphosphate-linked moiety X motif 12, nudix (nucleoside diphosphate linked moiety X)-type motif 12, Nudix motif 12, peroxisomal NADH pyrophosphatase NUDT12
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BQG2
• Gene Symbols: NUDT12
• Immunogen: Synthetic peptides corresponding to NUDT12(nudix (nucleoside diphosphate linked moiety X)-type motif 12) The peptide sequence was selected from the C terminal of NUDT12. Peptide sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 83594
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG