NUDT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257066

Catalog No. NBP257066

Description

NUDT2 Polyclonal specifically detects NUDT2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NUDT2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Ap4A hydrolase, Ap4A hydrolase 1, Ap4Aase, APAH1Diadenosine 5'-5'''-P1, bis(5'-nucleosyl)-tetraphosphatase (asymmetrical), bis(5'-nucleosyl)-tetraphosphatase [asymmetrical], diadenosine 5'-5''-P1, Diadenosine tetraphosphatase, EC 3.6.1.17, MGC10404, Nucleoside diphosphate-linked moiety X motif 2, nudix (nucleoside diphosphate linked moiety X)-type motif 2, Nudix motif 2, P4-tetraphosphate asymmetrical hydrolase, P4-tetraphosphate pyrophosphohydrolase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NUDT2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR
• Quantity: 100 μL
• Research Discipline: Angiogenesis, Apoptosis
• Gene ID (Entrez): 318
• Target Species: Human
• Isotype: IgG

For Research Use Only