Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUP50 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | NUP50 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NUP50 Polyclonal specifically detects NUP50 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| NUP50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 50 kDa nucleoporin, MGC39961, NPAP60, NPAP60LNucleoporin Nup50, nuclear pore complex protein Nup50, Nuclear pore-associated protein 60 kDa-like, nuclear pore-associated protein 60L, nucleoporin 50kD, nucleoporin 50kDa | |
| NUP50 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10762 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title