Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NUT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $695.50

Specifications

Antigen	NUT
Concentration	0.4mg/mL
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB432788 View Documents View Product Certificates	Novus Biologicals NBP18417625UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP184176 View Documents View Product Certificates	Novus Biologicals NBP184176	0.1 mL	Each for $695.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NUT Polyclonal specifically detects NUT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	NUT
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	C15orf55, chromosome 15 open reading frame 55, DKFZp434O192, FAM22H, MGC138683, MGC138684, Nuclear protein in testis, NUT, protein NUT
Gene Symbols	NUTM1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Concentration	0.4mg/mL
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	256646
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSA
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NUT Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents