Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OATL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OATL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OATL1 Polyclonal specifically detects OATL1 in Human samples. It is validated for Western Blot.Specifications
OATL1 | |
Polyclonal | |
Rabbit | |
Q3MII6 | |
4943 | |
Synthetic peptides corresponding to TBC1D25(TBC1 domain family, member 25) The peptide sequence was selected from the N terminal of TBC1D25. Peptide sequence KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MG81, MGC126866, MGC126868, MGC149732, OATL1MGC149731, ornithine aminotransferase-like 1, TBC1 domain family member 25, TBC1 domain family, member 25 | |
TBC1D25 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title