Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OATP1B3/SLCO1B3/OATP8 Antibody (CL3771), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP261637
Description
OATP1B3/SLCO1B3/OATP8 Monoclonal specifically detects OATP1B3/SLCO1B3/OATP8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
OATP1B3/SLCO1B3/OATP8 | |
Monoclonal | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SLCO1B3 | |
This antibody was developed against a recombinant protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Immunohistochemistry | |
CL3771 | |
Immunohistochemistry 1:500 - 1:10000 | |
Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3 | |
Mouse | |
Protein A purified | |
Cancer | |
28234 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction