Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OATP1B3/SLCO1B3/OATP8 Antibody (CL3771), Novus Biologicals™
SDP

Catalog No. NBP261637 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP261637 100 μL
NB393088 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP261637 Supplier Novus Biologicals Supplier No. NBP261637
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

OATP1B3/SLCO1B3/OATP8 Monoclonal specifically detects OATP1B3/SLCO1B3/OATP8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen OATP1B3/SLCO1B3/OATP8
Applications Immunohistochemistry
Classification Monoclonal
Clone CL3771
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:10000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3
Gene Symbols SLCO1B3
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Purification Method Protein A purified
Quantity 100 μL
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 28234
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.