OATP1B3/SLCO1B3/OATP8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP18098025UL

Catalog No. NB434007

Description

OATP1B3/SLCO1B3/OATP8 Polyclonal specifically detects OATP1B3/SLCO1B3/OATP8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OATP1B3/SLCO1B3/OATP8
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9NPD5
• Gene Symbols: SLCO1B3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 28234
• Target Species: Human
• Isotype: IgG

For Research Use Only