Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OAZ3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OAZ3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OAZ3 Polyclonal specifically detects OAZ3 in Human samples. It is validated for Western Blot.Specifications
OAZ3 | |
Polyclonal | |
Rabbit | |
Q9UMX2 | |
51686 | |
Synthetic peptides corresponding to OAZ3 (ornithine decarboxylase antizyme 3) The peptide sequence was selected from the middle region of OAZ3. Peptide sequence DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
antizyme 3, AZ3, OAZ-t, ODC-Az 3, ornithine decarboxylase antizyme 3, TISP15 | |
OAZ3 | |
IgG | |
21 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title