Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OBP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24734925UL
Description
OBP2A Polyclonal specifically detects OBP2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
OBP2A | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
hOBPIIa, OBP, OBP2C, OBPIIa, odorant binding protein 2A, odorant-binding protein 2a, Odorant-binding protein IIa, putative odorant-binding protein 2c | |
Rabbit | |
Affinity Purified | |
RUO | |
29991 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
OBP2A | |
This antibody was developed against a recombinant protein corresponding to amino acids: RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction