Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OCT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
Antigen | OCT1 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
44470 Polyclonal specifically detects 44470 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
OCT1 | |
Polyclonal | |
Rabbit | |
Human | |
P14859 | |
5451 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FLJ42836, Oct-1, OCT1class 2, transcription factor 1, POU class 2 homeobox 1, POU domain class 2, transcription factor 1 | |
POU2F1 | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title