OCT6. Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310963100UL

Catalog No. NB126825

Description

44475 Polyclonal specifically detects 44475 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OCT6.
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry-Paraffin
• Gene Alias: Oct-6, OCT6POU domain transcription factor SCIP, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF6, OTF-6, POU class 3 homeobox 1, POU domain class 3, transcription factor 1, POU domain, class 3, transcription factor 1, SCIP
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat OCT6 (NP_620193). Peptide sequence CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD
• Quantity: 100 μg
• Research Discipline: Cellular Markers
• Gene ID (Entrez): 5453
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified