Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ODF3L1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ODF3L1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15639220
|
Novus Biologicals
NBP15639220UL |
20 μL |
Each for $152.22
|
|
NBP156392
|
Novus Biologicals
NBP156392 |
100 μL |
Each for $436.00
|
|
Description
ODF3L1 Polyclonal specifically detects ODF3L1 in Human samples. It is validated for Western Blot.Specifications
| ODF3L1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC48986, outer dense fiber of sperm tails 3-like 1, outer dense fiber protein 3-like protein 1 | |
| ODF3L1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IXM7 | |
| 161753 | |
| Synthetic peptides corresponding to ODF3L1(outer dense fiber of sperm tails 3-like 1) The peptide sequence was selected from the N terminal of ODF3L1. Peptide sequence KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title