Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ODF3L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ODF3L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15639220
![]() |
Novus Biologicals
NBP15639220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP156392
![]() |
Novus Biologicals
NBP156392 |
100 μL |
Each for $487.50
|
|
|||||
Description
ODF3L1 Polyclonal specifically detects ODF3L1 in Human samples. It is validated for Western Blot.Specifications
ODF3L1 | |
Polyclonal | |
Rabbit | |
Q8IXM7 | |
161753 | |
Synthetic peptides corresponding to ODF3L1(outer dense fiber of sperm tails 3-like 1) The peptide sequence was selected from the N terminal of ODF3L1. Peptide sequence KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC48986, outer dense fiber of sperm tails 3-like 1, outer dense fiber protein 3-like protein 1 | |
ODF3L1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title