ODF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160018

Catalog No. NBP160018

Description

ODF4 Polyclonal specifically detects ODF4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ODF4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cancer/testis antigen 134, cancer/testis antigen 136, CT134, CT136, hOPPO1, MGC138215, OPPO1MGC138219, outer dense fiber 4, outer dense fiber of sperm tails 4, Outer dense fiber of sperm tails protein 4, outer dense fiber protein 4, Testis-specific protein oppo 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q2M2E3
• Gene Symbols: ODF4
• Immunogen: Synthetic peptides corresponding to ODF4(outer dense fiber of sperm tails 4) The peptide sequence was selected from the N terminal of ODF4. Peptide sequence MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 146852
• Target Species: Human
• Isotype: IgG