ODZ3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438353	Novus Biologicals NBP21368725UL	25ul
NBP213687	Novus Biologicals NBP213687	0.1 mL

Description

ODZ3 Polyclonal specifically detects ODZ3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ODZ3
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: FLJ10474, FLJ10886, KIAA1455odd Oz/Ten-m homolog 3, odz, odd Oz/ten-m homolog 3 (Drosophila), ODZ3-like protein, Protein Odd Oz/ten-m homolog 3, ten-3, tenascin-M3, teneurin-3, Ten-m3, TNM3
• Gene Symbols: TENM3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Vision
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 55714
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only